Geothrix oryzae: GETHOR_10790 Help Entry GETHOR_10790      CDS       T09137                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism gex  Geothrix oryzae Pathway gex03060   Protein export gex03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:gex00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GETHOR_10790  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GETHOR_10790  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:gex02044]     GETHOR_10790 Secretion system [BR:gex02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    GETHOR_10790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BDU68978 LinkDB All DBs Position complement(1221321..1221506) Genome browser AA seq 61 aa AA seqDB search MGNLGMMEILLIGIALLIFFGPSRLPELGKSLGKGIQEFKKASKELTDSVKEDVTSDKDK K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgggcaacctcggaatgatggaaatcctgctgatcggcatcgccctgctgatcttcttc ggcccctcccgcctgccggaactgggcaagagcctcggcaagggcatccaggagttcaag aaggccagcaaggagctgacggattccgtgaaggaagatgtcacctccgacaaggacaag aagtag

DBGET integrated database retrieval system