Geothrix oryzae: GETHOR_21500
Help
Entry
GETHOR_21500 CDS
T09137
Name
(GenBank) hypothetical protein
KO
K02034
peptide/nickel transport system permease protein
Organism
gex
Geothrix oryzae
Pathway
gex02024
Quorum sensing
Brite
KEGG Orthology (KO) [BR:
gex00001
]
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
GETHOR_21500
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
gex02000
]
GETHOR_21500
Transporters [BR:
gex02000
]
ABC transporters, prokaryotic type
Peptide and nickel transporters
Peptides/nickel transporter
GETHOR_21500
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
BDU70049
UniProt:
A0ABM8DSS3
LinkDB
All DBs
Position
2410220..2410924
Genome browser
AA seq
234 aa
AA seq
DB search
MKGRLLFLLALLLPDLPLDPFRGGAAVSFRHPLGLDDLGRDALLRLLLAGARSLGFASAC
ALLALATALLLAWYGRRGRGALSALRSVPPLLFLLPLAAATGGLSLPVLFLVMGLLLAPH
LEAPLRMRLEAFRRSPAWAAERVLGASPASTLRRWAPWGLDQAASLFPGAWLGALWGEAT
LSALGLGPGPGRDSLGRLLSEELPRLTTDPSPLGWAALAAVLGLAWVSVPRRPA
NT seq
705 nt
NT seq
+upstream
nt +downstream
nt
atgaaggggcggctcctcttcctgctggccctgctgctgccagacctccccctggatccc
ttccggggcggggcggcggtgtccttccggcatcccctgggcctggacgacctcggccgg
gacgccttgctgcgcttgctgctggccggcgcgcgcagcctgggtttcgccagtgcgtgc
gccctgctggccctcgcgaccgccctccttctcgcgtggtacggacggcggggccgaggc
gccctctccgccctccgcagcgtgccgcccctgctcttcctgctgccgctggccgccgcc
acgggcggcctctccctgccggtcctcttcctcgtcatgggcctcctcctggctccgcac
ctcgaagcgcccctccgcatgaggctcgaagccttccgccgctcgccggcctgggccgcc
gagcgcgtcctgggggcgtcccccgcctccacgcttcgccgctgggcgccctggggcctg
gatcaggccgcctcgctctttccgggcgcctggctcggcgccctgtggggcgaggccacc
ctgtccgccctcggcctgggccccggtcccggccgggacagcctgggacggctgctctcc
gaggagctgccccgcctcaccacggacccgagccccctgggctgggccgccctggcggcg
gtgctggggttggcctgggtgtccgtgccgcggaggccggcctga
DBGET
integrated database retrieval system