Geothrix oryzae: GETHOR_25840 Help Entry GETHOR_25840      CDS       T09137                                  Name (GenBank) hypothetical protein   KO K03073   preprotein translocase subunit SecE Organism gex  Geothrix oryzae Pathway gex02024   Quorum sensing gex03060   Protein export gex03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:gex00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GETHOR_25840  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GETHOR_25840  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GETHOR_25840  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:gex02044]     GETHOR_25840 Secretion system [BR:gex02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    GETHOR_25840 SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-ProteinID:  BDU70483 UniProt:  A0ABN6V237 LinkDB All DBs Position complement(2922812..2923006) Genome browser AA seq 64 aa AA seqDB search MIGAIKQQARDLFAELDRVDWPSKEKVLTSTWTVVIVSVFVGAFLWSVDWFLSKGFAYFF LKAR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt gtgatcggagccatcaaacaacaggccagagatctgttcgcagagctcgaccgggtggat tggcccagcaaggagaaagtgctgacctccacctggactgtggtgatcgtctcggtgttc gtcggggccttcctgtggtccgtggactggttcctctccaagggcttcgcgtacttcttc ctgaaggcccgttga

DBGET integrated database retrieval system