Gluconobacter frateurii: MKW11_10575 Help Entry MKW11_10575       CDS       T08020                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gfa  Gluconobacter frateurii Pathway gfa01100   Metabolic pathways gfa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gfa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MKW11_10575    00074 Mycolic acid biosynthesis     MKW11_10575   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MKW11_10575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  UMM07659 LinkDB All DBs Position 2280509..2280748 Genome browser AA seq 79 aa AA seqDB search MSDIADKVKKIVVEHLGVEESKVTPEASFIDDLGADSLDTVELVMAFEEAFSVEIPEDAA EKIATVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgacaaggtgaagaagatcgttgtcgagcacctcggcgttgaagaa agcaaggtcacgccggaagcgtctttcattgacgatctgggcgcagacagcctcgacacg gtcgagctggtcatggctttcgaagaagctttctccgtcgagatcccggaagatgcagcc gagaagatcgctaccgtcaaggacgcgattgactacatcgagaagcagaaggctgcctga

DBGET integrated database retrieval system