Geosporobacter ferrireducens: Gferi_10550 Help Entry Gferi_10550       CDS       T04493                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gfe  Geosporobacter ferrireducens Pathway gfe01100   Metabolic pathways gfe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gfe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Gferi_10550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Gferi_10550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 DUF5783 DUF1896 Motif Other DBs NCBI-ProteinID:  AOT69986 UniProt:  A0A1D8GGI6 LinkDB All DBs Position 2228309..2228539 Genome browser AA seq 76 aa AA seqDB search MVFEKIKQIIIDQLGLDDDVEITMDSSLMKDLEADSLDAVEIIMGIEDEFDVEIPDEDAE AFKNIGDIVRYVEEKM NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggtatttgaaaagataaaacaaattattatcgatcaattaggtttagacgatgacgta gagatcacaatggactcttctctcatgaaagacttagaagcagattcgctggatgctgtg gaaattattatgggaatcgaagatgaatttgatgtagaaattcccgatgaagatgcagaa gcttttaaaaacatcggtgatattgtcagatatgtagaggaaaaaatgtag

DBGET integrated database retrieval system