Geospiza fortis (medium ground-finch): 102032240 Help Entry 102032240         CDS       T03755                                  Symbol CENPS, APITD1 Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     102032240 (CENPS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gfr03036]     102032240 (CENPS)    03400 DNA repair and recombination proteins [BR:gfr03400]     102032240 (CENPS) Chromosome and associated proteins [BR:gfr03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      102032240 (CENPS) DNA repair and recombination proteins [BR:gfr03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      102032240 (CENPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone DUF3381 TFIID-31kDa Bromo_TP TAF Motif Other DBs NCBI-GeneID:  102032240 NCBI-ProteinID:  XP_014165255 UniProt:  A0A6I9Z864 LinkDB All DBs Position Un AA seq 130 aa AA seqDB search MLAQRLKAAVHYTVGCLCQEVEEDKDVQFSKQSIAAISEITFRQCEIFAKDLEMFARHAK RTTVTTEDVKLLARRSNSLLKYITQKSEELASSNMEQKEKKKKKSSAAKGERTPGEQEAA VTENEDSNMA NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgctcgcacagaggctgaaggcggcggttcactacacagtcgggtgcctgtgccaggag gtggaggaggacaaggacgtgcagttcagcaagcagagcatcgcagccatctcggagatc accttccggcagtgcgaaatcttcgcaaaagaccttgaaatgtttgcaaggcatgcaaaa cgaaccacagtcactacagaagatgtgaagcttttggctagaagaagcaattctttgcta aaatatatcactcagaagagtgaagagcttgcatcaagtaacatggagcagaaggagaag aagaaaaagaagtccagcgcagctaagggagagagaactcctggggaacaagaagcagct gtgactgaaaatgaagattccaacatggcatga

DBGET integrated database retrieval system