Geospiza fortis (medium ground-finch): 102033208 Help Entry 102033208         CDS       T03755                                  Symbol RPS27A Name (RefSeq) ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr03010   Ribosome gfr04120   Ubiquitin mediated proteolysis gfr04137   Mitophagy - animal gfr04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     102033208 (RPS27A)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102033208 (RPS27A)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102033208 (RPS27A)    04137 Mitophagy - animal     102033208 (RPS27A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:gfr03011]     102033208 (RPS27A)    04121 Ubiquitin system [BR:gfr04121]     102033208 (RPS27A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfr04147]     102033208 (RPS27A) Ribosome [BR:gfr03011]  Ribosomal proteins   Eukaryotes    Small subunit     102033208 (RPS27A)   Archaea     102033208 (RPS27A) Ubiquitin system [BR:gfr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    102033208 (RPS27A) Exosome [BR:gfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102033208 (RPS27A)   Exosomal proteins of colorectal cancer cells    102033208 (RPS27A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 Dsc3_N IBR TBK1_ULD Ubiquitin_5 OTU1_UBXL Motif Other DBs NCBI-GeneID:  102033208 NCBI-ProteinID:  XP_005422655 UniProt:  A0A6I9HJ96 LinkDB All DBs Position Un AA seq 156 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE CPSEECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctcacggggaaaaccatcacccttgaggttgaaccttct gatactatagaaaatgtaaaagcgaagatccaggataaggagggcattcctccggatcag cagcggctgatcttcgctgggaagcagttggaggatggacgcacactgtccgactacaac attcagaaagaatcaacccttcacctggtgctgagacttcgtggtggtgctaagaaaagg aagaagaagtcttacacgactcccaagaagaacaagcacaagagaaagaaggttaagctt gcagtgctcaagtattacaaggtggatgagaacggcaagatcagccgcctgcgccgggag tgcccctcggaggagtgtggggctggagtcttcatggccagccactttgacaggcactac tgtggcaagtgctgtctgacatactgcttcaataagccagaagacaagtaa

DBGET integrated database retrieval system