Geospiza fortis (medium ground-finch): 102033647 Help Entry 102033647         CDS       T03755                                  Name (RefSeq) trypsin-like   KO K01312   trypsin [EC:3.4.21.4] Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04080   Neuroactive ligand-receptor interaction gfr05164   Influenza A Brite KEGG Orthology (KO) [BR:gfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102033647  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102033647  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:gfr01002]     102033647   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfr04147]     102033647 Enzymes [BR:gfr01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.21  Serine endopeptidases     3.4.21.4  trypsin      102033647 Peptidases and inhibitors [BR:gfr01002]  Serine peptidases   Family S1: chymotrypsin family    102033647 Exosome [BR:gfr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102033647 SSDB OrthologParalogGFIT Motif Pfam:  Trypsin DUF8615 Motif Other DBs NCBI-GeneID:  102033647 NCBI-ProteinID:  XP_005431632 UniProt:  A0A6I9HUC1 LinkDB All DBs Position Un AA seq 130 aa AA seqDB search RIQVQLGKHNLELTESTQQFINSAKVIRHSGFSSYTLDNDIMLIKLATPATLSKAVQTVP LPTSCVAAGTTCLISGWGNTLSSGSNYPDQLQCLKAPVLTAEQCSDAYPGQITNNMMCVG YVEGGKDSCQ NT seq 391 nt NT seq  +upstreamnt  +downstreamnt tcgcatccaagtgcagctcgggaaacacaacctggagctcaccgaatccacacagcagtt tatcaactctgctaaagtcatccgccactctggcttcagctcctacaccctggacaatga catcatgctcatcaagctggccaccccagccacgctcagcaaagctgtccaaaccgttcc tctgcctaccagctgcgtggccgccggcaccacctgcctgatctccggctggggcaacac tctcagcagtggctccaactaccccgaccagctgcagtgcctgaaggctccggtcctcac cgccgagcagtgctctgatgcctaccctgggcaaattaccaacaacatgatgtgtgtcgg atacgtggagggaggaaaagactcctgccag

DBGET integrated database retrieval system