Geospiza fortis (medium ground-finch): 102034721 Help Entry 102034721         CDS       T03755                                  Symbol PROK2 Name (RefSeq) prokineticin 2   KO K24191   prokineticin Organism gfr  Geospiza fortis (medium ground-finch) Brite KEGG Orthology (KO) [BR:gfr00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gfr04052]     102034721 (PROK2) Cytokines and neuropeptides [BR:gfr04052]  Cytokines   Chemokines    102034721 (PROK2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prokineticin MIT_LIKE_ACTX DIKK1-2-4_C-subdom1 Motif Other DBs NCBI-GeneID:  102034721 NCBI-ProteinID:  XP_005420278 UniProt:  A0A6I9HG18 LinkDB All DBs Position Un AA seq 85 aa AA seqDB search MQACDRDQQCGAGMCCAVSLWIRSLRMCTPMGNLGDECHPLSHRVPFSGRRMHHTCPCLP GLACLRTAPSRFRCLPDFRKEDVFF NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaggcctgcgaccgagaccagcagtgcggggccgggatgtgctgcgccgtcagcctc tggatccgcagcctcaggatgtgcacccccatgggaaacctgggagacgagtgccacccc ctgagtcacagagtgcccttctcggggcggcggatgcaccacacgtgcccctgcctgccg ggcctggcctgcctcaggactgctcccagcagattcaggtgtctgccagacttcagaaaa gaagatgtctttttttag

DBGET integrated database retrieval system