Geospiza fortis (medium ground-finch): 102034950 Help Entry 102034950         CDS       T03755                                  Symbol FKBP1A Name (RefSeq) FK506 binding protein 1A   KO K09568   FK506-binding protein 1 [EC:5.2.1.8] Organism gfr  Geospiza fortis (medium ground-finch) Brite KEGG Orthology (KO) [BR:gfr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:gfr03110]     102034950 (FKBP1A) Enzymes [BR:gfr01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      102034950 (FKBP1A) Chaperones and folding catalysts [BR:gfr03110]  Protein folding catalysts   Peptidyl prolyl isomerase    FKBP     102034950 (FKBP1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FKBP_C Motif Other DBs NCBI-GeneID:  102034950 NCBI-ProteinID:  XP_005422242 UniProt:  A0A6I9HI45 LinkDB All DBs Position Un AA seq 79 aa AA seqDB search MLEDGKKFDSSRDRNKPFKFVMGKQEVIRGWEEGVAQMSVGQRAKMTISPDYAYGSTGHP GIIPPNATLIFDVELMKLE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgctggaggatgggaagaagtttgattcctcccgcgacaggaacaagccgttcaagttt gtgatgggcaagcaggaggtgatccgtggctgggaggaaggagtcgctcagatgagcgtt ggtcagcgggcaaagatgaccatctccccagattatgcctacggctccactggccaccca gggatcatcccaccaaacgccactctaatttttgacgtggagctcatgaaattggaatga

DBGET integrated database retrieval system