Geospiza fortis (medium ground-finch): 102035167 Help Entry 102035167         CDS       T03755                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04080   Neuroactive ligand-receptor interaction gfr04081   Hormone signaling Brite KEGG Orthology (KO) [BR:gfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102035167 (SST)    04081 Hormone signaling     102035167 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gfr04052]     102035167 (SST) Cytokines and neuropeptides [BR:gfr04052]  Neuropeptides   GPCR binding    102035167 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin Motif Other DBs NCBI-GeneID:  102035167 NCBI-ProteinID:  XP_014167741 LinkDB All DBs Position Un AA seq 94 aa AA seqDB search MKAYSLMIFITFAPQFGTDEEDEAELAKYFLAELLSEPSQTENEALESEDLSRGAEQDEV RLELERSANSNPALAPRERKAGCKNFFWKTFTSC NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaggcttattctctcatgattttcattacttttgctccacaatttgggacagatgaa gaggatgaagctgaactggccaaatactttttggcagaactgctttcagagccaagtcag acagaaaatgaagccctggagtctgaggacttgtcccgaggggctgagcaggatgaagtg agactggagctggagcgctcggctaactcaaatcccgctctggcaccccgggaacgcaaa gcaggctgcaagaacttcttctggaaaactttcacatcctgttag

DBGET integrated database retrieval system