Geospiza fortis (medium ground-finch): 102036055 Help Entry 102036055         CDS       T03755                                  Symbol CDC42 Name (RefSeq) cell division cycle 42   KO K04393   cell division control protein 42 Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04010   MAPK signaling pathway gfr04144   Endocytosis gfr04370   VEGF signaling pathway gfr04510   Focal adhesion gfr04520   Adherens junction gfr04530   Tight junction gfr04810   Regulation of actin cytoskeleton gfr04912   GnRH signaling pathway gfr05100   Bacterial invasion of epithelial cells gfr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102036055 (CDC42)    04370 VEGF signaling pathway     102036055 (CDC42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102036055 (CDC42)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102036055 (CDC42)    04520 Adherens junction     102036055 (CDC42)    04530 Tight junction     102036055 (CDC42)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102036055 (CDC42)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     102036055 (CDC42)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102036055 (CDC42)    05100 Bacterial invasion of epithelial cells     102036055 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gfr04131]     102036055 (CDC42)    03036 Chromosome and associated proteins [BR:gfr03036]     102036055 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfr04147]     102036055 (CDC42)    04031 GTP-binding proteins [BR:gfr04031]     102036055 (CDC42) Membrane trafficking [BR:gfr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     102036055 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     102036055 (CDC42)   Macropinocytosis    Ras GTPases     102036055 (CDC42) Chromosome and associated proteins [BR:gfr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102036055 (CDC42) Exosome [BR:gfr04147]  Exosomal proteins   Exosomal proteins of microglial cells    102036055 (CDC42)   Exosomal proteins of breast milk    102036055 (CDC42) GTP-binding proteins [BR:gfr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     102036055 (CDC42) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  102036055 NCBI-ProteinID:  XP_005428223 UniProt:  A0A8N5I2D4 LinkDB All DBs Position Un AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKTRRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacgatcaagtgtgtagtagtgggtgatggtgctgttggtaaaacctgtctctta atttcttatacaacaaataaattcccatcggaatacgtaccaacggttttcgataactat gctgtaacagtgatgattggaggagagccttacacccttggcctcttcgatactgcaggt caggaagactatgatagattacgacccctcagctatccacagacagatgtatttctggtc tgtttctcagtggtctctccttcttcatttgaaaatgtgaaagaaaagtgggtacctgaa attactcaccactgtccaaagactccttttctgcttgtcgggacccagattgatttaaga gatgatccctcaacaattgagaaacttgccaagaacaagcagaagcccataactccagag actgctgaaaagctggcccgggacctgaaggctgtaaaatacgtggaatgctctgcactt acgcagaaaggcctaaagaatgtatttgacgaagcgatattggctgccctggagcccccg gagccgaagaagactcgcaggtgtgtgctgctatga

DBGET integrated database retrieval system