Geospiza fortis (medium ground-finch): 102036125 Help Entry 102036125         CDS       T03755                                  Symbol PFN2 Name (RefSeq) profilin 2   KO K05759   profilin Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04810   Regulation of actin cytoskeleton gfr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gfr00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102036125 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102036125 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gfr04131]     102036125 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:gfr04812]     102036125 (PFN2)    04147 Exosome [BR:gfr04147]     102036125 (PFN2) Membrane trafficking [BR:gfr04131]  Others   Actin-binding proteins    Others     102036125 (PFN2) Cytoskeleton proteins [BR:gfr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102036125 (PFN2) Exosome [BR:gfr04147]  Exosomal proteins   Proteins found in most exosomes    102036125 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102036125 NCBI-ProteinID:  XP_005419245 LinkDB All DBs Position Un AA seq 106 aa AA seqDB search MAQCHRTFVQPGEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQG GEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcgcagtgtcaccggacctttgtgcagccaggagaaatagatatgattgtaggaaaa gaccgagagggtttcttcaccaatggtctgacccttggtgcaaagaagtgctctgtgatc agagatagcctgtatgtcgatggtgactgcacaatggacatcaggacaaagagtcaaggt ggtgagccgacatataatgttgctgtaggcagagctggacgagtcttggtctttgtaatg ggcaaagaaggggtccatggaggcggattgaataagaaggcatactcaatggcaaaatac ttgagagactctgggttctag

DBGET integrated database retrieval system