Geospiza fortis (medium ground-finch): 102036302 Help Entry 102036302         CDS       T03755                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr03082   ATP-dependent chromatin remodeling gfr04217   Necroptosis Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102036302  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102036302  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gfr03036]     102036302   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfr04147]     102036302 Chromosome and associated proteins [BR:gfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102036302 Exosome [BR:gfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102036302 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF DUF5870 Motif Other DBs NCBI-GeneID:  102036302 NCBI-ProteinID:  XP_005421734 LinkDB All DBs Position Un AA seq 113 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGTAKAGRPKKAAKSPAKAKAVKPKAAKPKAAKPKAAKAKKAAPKKK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcgggaagcagggcggcaaggcgcgggctaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccggctgctgcgcaagggcaactac gcggagcgcgtgggcgccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcggggaccgccaaggccgggcgccccaagaaggcggccaag agcccggctaaggcaaaggccgtgaagcccaaagcggccaagcccaaggcagccaaaccc aaagcggccaaggcgaagaaggcggcgcccaaaaagaagtaa

DBGET integrated database retrieval system