Geospiza fortis (medium ground-finch): 102037376 Help Entry 102037376         CDS       T03755                                  Symbol GNG5 Name (RefSeq) G protein subunit gamma 5   KO K04542   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:gfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     102037376 (GNG5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfr04147]     102037376 (GNG5)    04031 GTP-binding proteins [BR:gfr04031]     102037376 (GNG5) Exosome [BR:gfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102037376 (GNG5) GTP-binding proteins [BR:gfr04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     102037376 (GNG5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma Motif Other DBs NCBI-GeneID:  102037376 NCBI-ProteinID:  XP_014162905 LinkDB All DBs Position Un AA seq 91 aa AA seqDB search MDAARAARPCPRSEKRRALGLCREPARGGAHNRLGWPGAARWRCRCQAHQVSQAAADLKQ FCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggacgcggcccgcgctgcccgtccgtgccctcggagcgagaagcgccgtgccctcggg ctctgccgggagcctgcccgaggcggggcgcacaacaggctgggctggcccggcgcggca agatggagatgtcgctgccaggcacaccaagtttctcaagctgcagctgacttgaagcaa ttctgcctgcagaatgcacaacatgatcccctactgacgggagtatcatcaagtacaaat ccattcagaccccagaaagtttgttcatttttgtaa

DBGET integrated database retrieval system