Geospiza fortis (medium ground-finch): 102037457 Help Entry 102037457         CDS       T03755                                  Symbol DCTN3 Name (RefSeq) dynactin subunit 3   KO K10425   dynactin 3 Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04814   Motor proteins gfr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gfr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102037457 (DCTN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102037457 (DCTN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gfr03036]     102037457 (DCTN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:gfr04812]     102037457 (DCTN3) Chromosome and associated proteins [BR:gfr03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      102037457 (DCTN3) Cytoskeleton proteins [BR:gfr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      102037457 (DCTN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynactin_p22 SIP Nmad2 Motif Other DBs NCBI-GeneID:  102037457 NCBI-ProteinID:  XP_014165423 UniProt:  A0A6I9ZCR1 LinkDB All DBs Position Un AA seq 111 aa AA seqDB search MAVPDTMKLQFILAEEQAVPARAALLEQVKNLQPILDSTSIQAVPDHAAKLQRLSQVHIQ QQEKRHDLTDSVKTLLEDYNKMTLLLSKQFVQWNEILTRLEVAKQAKPVAE NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggctgttccagacactatgaagctgcagttcatcttggcagaggaacaggccgttcct gcccgtgcagcccttctggagcaggtgaagaacctccagcccatcttggacagcaccagt atccaagcggttcctgaccacgcagccaaactgcagcggctctcacaggtccacatacag cagcaggagaagcgtcacgatctcactgacagtgtcaagacactccttgaggattacaac aaaatgaccctgcttctctccaagcagtttgtgcagtggaatgaaatcctgacacgtctg gaggtggccaagcaagcaaaacctgtggctgagtga

DBGET integrated database retrieval system