Geospiza fortis (medium ground-finch): 102039630 Help Entry 102039630         CDS       T03755                                  Symbol RAB3A Name (RefSeq) ras-related protein Rab-3A   KO K07882   Ras-related protein Rab-3A Organism gfr  Geospiza fortis (medium ground-finch) Brite KEGG Orthology (KO) [BR:gfr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gfr04131]     102039630 (RAB3A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfr04147]     102039630 (RAB3A)    04031 GTP-binding proteins [BR:gfr04031]     102039630 (RAB3A) Membrane trafficking [BR:gfr04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102039630 (RAB3A) Exosome [BR:gfr04147]  Exosomal proteins   Exosomal proteins of hepatic cells    102039630 (RAB3A) GTP-binding proteins [BR:gfr04031]  Small (monomeric) G-proteins   Rab Family    Rab3/27 [OT]     102039630 (RAB3A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 SRPRB Gtr1_RagA AAA_24 Septin Motif Other DBs NCBI-GeneID:  102039630 NCBI-ProteinID:  XP_005430416 UniProt:  A0A6I9HTB4 LinkDB All DBs Position Un AA seq 116 aa AA seqDB search MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK VKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDW NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgtcggctactgactcccgctatgggcagaaggaatcctcggaccagaacttcgat tacatgttcaagatcctgatcatcggcaacagcagcgtgggcaaaacctccttcctgttc cgctacgccgacgactccttcacgcccgccttcgtcagcaccgtcggcatcgacttcaag gtcaagaccatctacaggaacgacaaacgcatcaagctgcagatctgggacacggcgggg caggagcggtaccgcaccatcaccaccgcctactaccgcggggccatgggcttcatcctc atgtacgacatcaccaacgaggagtccttcaacgctgtgcaggactggtga

DBGET integrated database retrieval system