Geospiza fortis (medium ground-finch): 102039792 Help Entry 102039792         CDS       T03755                                  Symbol DUSP3 Name (RefSeq) dual specificity phosphatase 3   KO K17614   dual specificity phosphatase 3 [EC:3.1.3.16 3.1.3.48] Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04010   MAPK signaling pathway Brite KEGG Orthology (KO) [BR:gfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102039792 (DUSP3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gfr01009]     102039792 (DUSP3) Enzymes [BR:gfr01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.3  Phosphoric-monoester hydrolases     3.1.3.16  protein-serine/threonine phosphatase      102039792 (DUSP3)     3.1.3.48  protein-tyrosine-phosphatase      102039792 (DUSP3) Protein phosphatases and associated proteins [BR:gfr01009]  Protein tyrosine phosphatases (PTPs)   Class I PTPs (Dual specificity phosphatases)    Atypical DSPs     102039792 (DUSP3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSPc Y_phosphatase Init_tRNA_PT SNase PTPlike_phytase Myotub-related baeRF_family7 YjeF_N Motif Other DBs NCBI-GeneID:  102039792 NCBI-ProteinID:  XP_014166117 LinkDB All DBs Position Un AA seq 117 aa AA seqDB search MHVNTNAEFYEGSGIRYHGIKANDTQEFNLSRYFEEAADFIDKALSQKDGQVLVHCREGY SRSPTLVIAYLMLRRGMDVRSALCAVRQQREIGPNDGFLRQLCQLNERLLKEGKVKP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgcatgtgaacactaatgcagagttctatgaaggctcaggcatcagataccatggcatt aaagctaatgatacacaggaatttaacctcagtcgctactttgaggaggcagctgatttt attgacaaagccctttcccagaaggatggccaggtgctggtgcactgccgggagggctac agccgctcgcccacgctggtcatcgcctacctgatgctgcggcggggcatggacgtgcgc agcgcgctctgcgccgtgcgccagcagcgcgagatcggccccaacgacggcttcctcagg cagctctgccagctcaacgagcgcctgctgaaggagggcaaggtcaaaccctag

DBGET integrated database retrieval system