Geospiza fortis (medium ground-finch): 102040401 Help Entry 102040401         CDS       T03755                                  Symbol CLDN19 Name (RefSeq) claudin 19   KO K06087   claudin Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr03272   Virion - Hepatitis viruses gfr04382   Cornified envelope formation gfr04514   Cell adhesion molecules gfr04530   Tight junction Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102040401 (CLDN19)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102040401 (CLDN19)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102040401 (CLDN19)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102040401 (CLDN19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gfr03037]     102040401 (CLDN19)    04147 Exosome [BR:gfr04147]     102040401 (CLDN19)    04515 Cell adhesion molecules [BR:gfr04515]     102040401 (CLDN19) Cilium and associated proteins [BR:gfr03037]  Other cilia and associated proteins   Stereociliary proteins    102040401 (CLDN19) Exosome [BR:gfr04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102040401 (CLDN19)   Exosomal proteins of colorectal cancer cells    102040401 (CLDN19) Cell adhesion molecules [BR:gfr04515]  Immunoglobulin superfamily   L1 family    102040401 (CLDN19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM37 Motif Other DBs NCBI-GeneID:  102040401 NCBI-ProteinID:  XP_005428247 LinkDB All DBs Position Un AA seq 181 aa AA seqDB search WRQSSYAGDAIITAVGLHEGLWMSCAAQSTGQVQCRLHDSLLSLEVHIQTCRALMVISLL LGFFGIIVSVVGMKCTKVGEEDPVTKSRIAVAGGVLFILSGLCTLAAVSLYATQVTYEFF RESTIPINARYEFGSALFVGWGAASLSMLGGSLLCCSCPAKERRGQQYHQQSQPSTAREY V NT seq 546 nt NT seq  +upstreamnt  +downstreamnt tggcgacagagctcgtacgccggggacgccatcatcacggccgtggggctccacgagggg ctgtggatgagttgcgccgcccagagcaccgggcaggtgcagtgccgcctgcacgactcg ctgctctccctcgaagttcacatccagacatgccgggctctcatggtcatttctctcctc ctgggcttctttggcatcatcgtgagcgtggtgggcatgaaatgcactaaagttggggag gaggatcctgttaccaaaagccgcatagctgttgctggaggtgttctcttcattctctct ggtctgtgcacactggctgccgtgtcattgtatgcaacacaggtgacctatgagttcttc agagagagcaccatccccatcaacgctaggtacgaattcggctctgctctcttcgtgggc tggggggccgccagcctctccatgttggggggatccctcctgtgctgctcctgccctgcc aaggagcgccgaggacagcagtaccatcagcagtcacagccctccacagcccgggagtat gtctga

DBGET integrated database retrieval system