Geospiza fortis (medium ground-finch): 102040521 Help Entry 102040521         CDS       T03755                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04060   Cytokine-cytokine receptor interaction gfr04218   Cellular senescence gfr04620   Toll-like receptor signaling pathway gfr04621   NOD-like receptor signaling pathway gfr04622   RIG-I-like receptor signaling pathway gfr05132   Salmonella infection gfr05164   Influenza A Brite KEGG Orthology (KO) [BR:gfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102040521  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102040521  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102040521    04621 NOD-like receptor signaling pathway     102040521    04622 RIG-I-like receptor signaling pathway     102040521  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102040521   09171 Infectious disease: bacterial    05132 Salmonella infection     102040521  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gfr04052]     102040521    00536 Glycosaminoglycan binding proteins [BR:gfr00536]     102040521 Cytokines and neuropeptides [BR:gfr04052]  Cytokines   Chemokines    102040521 Glycosaminoglycan binding proteins [BR:gfr00536]  Heparan sulfate / Heparin   Chemokines    102040521 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102040521 NCBI-ProteinID:  XP_014165947 UniProt:  A0A6I9ZDD0 LinkDB All DBs Position Un AA seq 92 aa AA seqDB search MAGSEGKALEKTDERGSQCQCISTHSKFIPPKTIQDVRLSQRGPHCKHVEIIATLRDGRE VCVEPAAPWIQLAVKTLLARARNNVESPVKEK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcagggtcagaaggtaaggccctggagaagacagatgaaagaggctcccaatgccag tgcataagcactcattccaagttcatccctcccaagactattcaggatgtgagattaagc caaagaggacctcactgcaaacatgtggaaatcatagctacgctgagagatggcagggaa gtgtgcgtggagcccgctgcgccctggatccagctcgctgtaaagactcttctggccagg gccaggaacaatgttgagtcaccagtcaaagaaaagtaa

DBGET integrated database retrieval system