Geospiza fortis (medium ground-finch): 102042732 Help Entry 102042732         CDS       T03755                                  Name (RefSeq) histone H2A-IV-like   KO K11251   histone H2A Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr03082   ATP-dependent chromatin remodeling gfr04217   Necroptosis Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102042732  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102042732  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gfr03036]     102042732   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfr04147]     102042732 Chromosome and associated proteins [BR:gfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102042732 Exosome [BR:gfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102042732 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102042732 NCBI-ProteinID:  XP_005422028 UniProt:  A0A6I9HI89 LinkDB All DBs Position Un AA seq 98 aa AA seqDB search HRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRND EELNKLLGKVTIAQGGVLPNIQAVLLPKKTDSHKAKAK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt caccggctgctgcgcaagggcaactacgcggagcgcgtgggcgccggcgcgccggtgtac ctggcggccgtgctggagtacctgacggccgagatcctggagctggcgggcaacgcggcc cgcgacaacaagaagacgcgcatcatcccccgccacctgcagctcgccatccgcaacgac gaggagctcaacaagctgctgggcaaggtgacgatcgcgcagggcggcgtgctgcccaac atccaggccgtgctgctgcccaagaagaccgacagccacaaggcgaaagccaagtaa

DBGET integrated database retrieval system