Geospiza fortis (medium ground-finch): 102043287 Help Entry 102043287         CDS       T03755                                  Symbol CLDN11 Name (RefSeq) claudin 11   KO K06087   claudin Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr03272   Virion - Hepatitis viruses gfr04382   Cornified envelope formation gfr04514   Cell adhesion molecule (CAM) interaction gfr04530   Tight junction Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102043287 (CLDN11)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     102043287 (CLDN11)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102043287 (CLDN11)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102043287 (CLDN11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gfr03037]     102043287 (CLDN11)    04147 Exosome [BR:gfr04147]     102043287 (CLDN11) Cilium and associated proteins [BR:gfr03037]  Other cilia and associated proteins   Stereociliary proteins    102043287 (CLDN11) Exosome [BR:gfr04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102043287 (CLDN11)   Exosomal proteins of colorectal cancer cells    102043287 (CLDN11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 zf-LITAF-like Motif Other DBs NCBI-GeneID:  102043287 NCBI-ProteinID:  XP_014167767 UniProt:  A0A6I9ZEZ9 LinkDB All DBs Position Un AA seq 174 aa AA seqDB search MVATCLHLAGFVCSFVGWIGVVVATATNDWVVTCGYTITTCRKMDELGSKGLWADCVMAT GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAIFPMCGVVATIWFPVCAHRETTIMS FGYSLYTGWIGSALCLFGGCVIVCCSGDAQTFGENRFYYGSGSSSPTHAKSAHV NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atggtggccacctgcctgcacctggctggatttgtctgcagcttcgtggggtggatcggg gtggttgtggccacggccaccaacgactgggtggtgacttgcggctacaccatcaccacc tgcaggaagatggacgagctgggatccaaggggctgtgggcagactgtgtcatggcaaca ggtctctatcactgcaagcccctcgtggacatcctcatactgccagggtacgtccaagcg tgccgagcgctgatgatcgccgcctccgtcctgggcctgcccgccatcttccccatgtgc ggcgtggtggccaccatctggttcccggtgtgcgcgcaccgcgagaccaccatcatgagc ttcggctactcgctctacacgggctggatcggctctgccctctgcctcttcggcggctgt gtcatcgtctgctgctcgggggacgcgcagaccttcggcgagaaccgcttctactacggc tcgggctccagctcgcccacccatgccaagagcgctcacgtgtag

DBGET integrated database retrieval system