Geospiza fortis (medium ground-finch): 102044755 Help Entry 102044755         CDS       T03755                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04020   Calcium signaling pathway gfr04070   Phosphatidylinositol signaling system gfr04114   Oocyte meiosis gfr04218   Cellular senescence gfr04261   Adrenergic signaling in cardiomyocytes gfr04270   Vascular smooth muscle contraction gfr04371   Apelin signaling pathway gfr04625   C-type lectin receptor signaling pathway gfr04744   Phototransduction gfr04910   Insulin signaling pathway gfr04912   GnRH signaling pathway gfr04916   Melanogenesis Brite KEGG Orthology (KO) [BR:gfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     102044755    04020 Calcium signaling pathway     102044755    04070 Phosphatidylinositol signaling system     102044755  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102044755    04218 Cellular senescence     102044755  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102044755   09152 Endocrine system    04910 Insulin signaling pathway     102044755    04912 GnRH signaling pathway     102044755    04916 Melanogenesis     102044755   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102044755    04270 Vascular smooth muscle contraction     102044755   09157 Sensory system    04744 Phototransduction     102044755  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gfr01009]     102044755   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gfr04131]     102044755    03036 Chromosome and associated proteins [BR:gfr03036]     102044755   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfr04147]     102044755 Protein phosphatases and associated proteins [BR:gfr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102044755 Membrane trafficking [BR:gfr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102044755 Chromosome and associated proteins [BR:gfr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102044755 Exosome [BR:gfr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102044755 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH SPARC_Ca_bdg EF-hand_11 Dockerin_1 EFhand_Ca_insen UPF0154 Caleosin DUF5580_M FCaBP_EF-hand Fe_hyd_lg_C SurA_N_2 SurA_N_3 SPEF2_C Motif Other DBs NCBI-GeneID:  102044755 NCBI-ProteinID:  XP_005427013 UniProt:  A0A6I9HPE0 LinkDB All DBs Position Un AA seq 149 aa AA seqDB search MAERLSEEKIAEFKEAFSLFDRDGDGCITTRELGTVMRSLGQNPTEAELQDMVGEVDADG SGTIDFPEFLSLMARKMRDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIKEADCNNDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcggctgtcggaggagaaaatcgcggaattcaaggaggctttttccctcttc gaccgcgacggcgacggctgcatcaccacgcgggagctgggcaccgtcatgcgctcgctg ggccagaaccccaccgaggccgagcttcaggacatggtgggcgaggtggacgccgacggc agcggcaccatcgacttccccgagttcctgtcgctgatggccaggaagatgagggacacg gacagcgaggaggagatccgggaggcgttccgggtctttgacaaggatgggaacggctac atcagcgcggccgagctgcggcacgtcatgaccaacctgggcgagaagctgacggacgag gaggtggacgagatgatcaaggaggccgactgcaacaacgacgggcaggtcaactacgag gagttcgtgaggatgatgacggagaagtga

DBGET integrated database retrieval system