Geospiza fortis (medium ground-finch): 102044763 Help Entry 102044763         CDS       T03755                                  Symbol CETN2 Name (RefSeq) centrin 2   KO K10840   centrin-2 Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09124 Replication and repair    03420 Nucleotide excision repair     102044763 (CETN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gfr03019]     102044763 (CETN2)    03036 Chromosome and associated proteins [BR:gfr03036]     102044763 (CETN2)    03400 DNA repair and recombination proteins [BR:gfr03400]     102044763 (CETN2) Messenger RNA biogenesis [BR:gfr03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      102044763 (CETN2) Chromosome and associated proteins [BR:gfr03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     102044763 (CETN2)    Centrosome duplication proteins     Centriole replication proteins      102044763 (CETN2) DNA repair and recombination proteins [BR:gfr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      XPC-HR23B-CETN2 complex       102044763 (CETN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_9 AIF-1 EF-hand_5 EH Dockerin_1 SurA_N_3 SurA_N_2 EF-hand_14 DUF7645 LETM1_RBD EF_EFCAB10_C FCaBP_EF-hand HEAT_Maestro SRI HGD-D SPEF2_C MJ1010-like_2nd SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  102044763 NCBI-ProteinID:  XP_014165739 UniProt:  A0A6I9Z8M9 LinkDB All DBs Position Un AA seq 116 aa AA seqDB search MRALGFEPKKEEIKKIISDIDKEGTGKISFSDFLAVMSQRMAEKDSKEEILKAFKLFDDD ETGKISFQNLKRVAKVLGENLTDEELQEMIDEADRDGDGQVSEQEFLRIMKKTGLY NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgagggccctggggtttgaacctaagaaagaagagatcaagaaaatcatctcagacatc gataaggaagggacaggaaaaatcagcttcagtgacttcctggcagtgatgtcacagaga atggctgaaaaagattccaaagaggagattctcaaagctttcaaactctttgatgatgat gagactggaaaaatctctttccaaaacctcaaacgtgtggccaaagtgctgggggagaac ctcactgatgaagagctgcaggagatgattgatgaggcagatcgggatggggatgggcaa gtgagcgagcaggaattcctgaggatcatgaagaagaccggcctgtactga

DBGET integrated database retrieval system