Glossina fuscipes (tsetse fly): 119631416 Help Entry 119631416         CDS       T09630                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism gfs  Glossina fuscipes (tsetse fly) Pathway gfs04013   MAPK signaling pathway - fly gfs04145   Phagosome gfs04148   Efferocytosis gfs04310   Wnt signaling pathway gfs04620   Toll-like receptor signaling pathway gfs05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:gfs00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     119631416    04310 Wnt signaling pathway     119631416  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     119631416    04148 Efferocytosis     119631416  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119631416  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     119631416  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gfs04131]     119631416   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfs04147]     119631416    04031 GTP-binding proteins [BR:gfs04031]     119631416 Membrane trafficking [BR:gfs04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119631416  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     119631416   Macropinocytosis    Ras GTPases     119631416  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     119631416 Exosome [BR:gfs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119631416   Exosomal proteins of other body fluids (saliva and urine)    119631416   Exosomal proteins of colorectal cancer cells    119631416   Exosomal proteins of bladder cancer cells    119631416 GTP-binding proteins [BR:gfs04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119631416 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  119631416 NCBI-ProteinID:  XP_037879519 UniProt:  A0A8U0W2Z7 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNVPIILVGTKLDLR DDKATIEKLKDKKLTPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV MRVKRSRKCILL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctattaagtgtgtggtggttggcgatggtgccgtgggtaaaacatgtttacta atcagttacacaaccaatgcgttccctggagaatatataccaacagtatttgataactat tcagctaatgttatggttgatgctaaaccaattaatttgggtctttgggatacggccggc caagaggattacgatcgtttgagacctttgtcttatccccaaactgatgtatttctaatt tgcttttctttggtaaatccagcttcatttgagaatgtacgggctaaatggtatcctgaa gtacgtcatcactgtcctaatgtgccaatcattctagtgggtacaaagttagatttacgc gacgataaggcgaccatagaaaagttgaaagataaaaaactaacacccattacatatcca caaggcttagccatggcgaaagagatcggtgctgtcaaatatttagaatgttcagcccta acgcaaaaagggcttaaaactgtcttcgatgaggccatacgttccgtattatgcccagtt atgcgtgtcaagagatcacgtaaatgtatattattgtaa

DBGET integrated database retrieval system