Glossina fuscipes (tsetse fly): 119633171 Help Entry 119633171         CDS       T09630                                  Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism gfs  Glossina fuscipes (tsetse fly) Brite KEGG Orthology (KO) [BR:gfs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gfs03036]     119633171 Chromosome and associated proteins [BR:gfs03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      119633171     MLL-HCF complex      119633171     MLL3/MLL4 complex      119633171 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 RIIa Motif Other DBs NCBI-GeneID:  119633171 NCBI-ProteinID:  XP_037882453 UniProt:  A0A8U0WBU3 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MEKVDTNSQGNLPTAESTQPIPSANSNASNPTAASQCKKNRSDLNALPTRQYLDQTVAPI LLHALQTLARERPADPINFLAAYLLKNKNRCEEAIPENV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggaaaaagttgatacaaattcacaaggaaacttgcctacagctgaatcaactcagcca ataccatctgcgaacagtaacgccagtaatcctaccgccgcatcgcaatgtaaaaagaat cgcagcgatttaaatgcattaccaacgcgccaatacttggatcaaactgtggcacctatt ttgctgcatgcattacaaactctggcacgggagcgtccagcagatcctatcaatttttta gctgcttatctattgaaaaataagaatcgctgtgaggaggctataccggaaaatgtgtaa

DBGET integrated database retrieval system