Glossina fuscipes (tsetse fly): 119638507 Help Entry 119638507         CDS       T09630                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism gfs  Glossina fuscipes (tsetse fly) Brite KEGG Orthology (KO) [BR:gfs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gfs03036]     119638507   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfs04147]     119638507 Chromosome and associated proteins [BR:gfs03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119638507 Exosome [BR:gfs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119638507 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  119638507 NCBI-ProteinID:  XP_037891251 UniProt:  A0A9C5Z3C6 LinkDB All DBs Position Unknown AA seq 72 aa AA seqDB search MGKFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD IQLARRIRGERA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgggcaaatttcaacgtttggtgcgcgaaatcgctcaagattttaaaacagatttgcgt ttccaaagctctgctgttatggcgttgcaggaagctagtgaagcgtacttagtcggcttg tttgaagacacaaatttgtgcgctattcatgctaaacgagttacaattatgcctaaagac atccaattggctcgacgtattcgtggagaacgtgcttaa

DBGET integrated database retrieval system