Glossina fuscipes (tsetse fly): 119638741 Help Entry 119638741         CDS       T09630                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism gfs  Glossina fuscipes (tsetse fly) Pathway gfs04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:gfs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119638741  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gfs04121]     119638741    03400 DNA repair and recombination proteins [BR:gfs03400]     119638741 Ubiquitin system [BR:gfs04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      119638741    Cul5 complex      119638741 DNA repair and recombination proteins [BR:gfs03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      119638741 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  119638741 NCBI-ProteinID:  XP_037891643 UniProt:  A0A9C5Z8V1 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRRKTTIFTDAKENTTVAELKRMLEGILKVRPLDQRLFNIENDVMDDETTLQD NGITVSTAKAQAPAQLGLVFRTDDGDFEPLEITSYSSPPDLPEVMKNQEAANGKEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatgtttttctgatgatccgaagacgtaaaacaaccatctttactgatgcgaaggaa aacaccacagtagccgaattgaaacgtatgctggagggtattctaaaagtaagacctttg gaccagaggctatttaatatagaaaatgatgttatggatgatgaaacaactttacaggat aacggcatcacagtgtcaacggcaaaagcacaggccccagctcaattaggtttagtgttc agaaccgacgacggtgattttgaaccattggaaatcacatcgtactcatcaccacccgat ttgcctgaagttatgaaaaatcaagaggcagcgaacggcaaagaacaagttgcatag

DBGET integrated database retrieval system