Gemmobacter fulvus: KM031_09390 Help Entry KM031_09390       CDS       T07830                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism gfu  Gemmobacter fulvus Brite KEGG Orthology (KO) [BR:gfu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gfu03036]     KM031_09390    03400 DNA repair and recombination proteins [BR:gfu03400]     KM031_09390 Chromosome and associated proteins [BR:gfu03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     KM031_09390 DNA repair and recombination proteins [BR:gfu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       KM031_09390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS K-box PspAA Mito_fiss_reg SUS_EPBD Motif Other DBs NCBI-ProteinID:  QWK89094 UniProt:  A0A975P3E3 LinkDB All DBs Position 1925181..1925489 Genome browser AA seq 102 aa AA seqDB search MDINALSLKELKDLQSQIAKAIVSYEDRKKKEALAELEDRARAMGFTLAELTGTPVTRKR APASAKYANPDNTSETWSGRGRKPRWFDAALKAGKSVDDLAI NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggacatcaatgcactttcgttgaaagagctgaaagaccttcaatcgcagattgccaag gcaattgtgtcatatgaagatcgcaagaaaaaagaagcacttgccgaacttgaagaccgg gcacgcgccatgggctttacgctggcagaactgaccggaacgccggtgacgcgcaagcgc gcgcccgcttcggccaaatatgcgaaccccgataatacgtcggaaacctggtctggccgt ggccgcaagccgcgctggtttgatgccgcgctgaaagcgggcaagtcggtcgacgatctg gcgatttaa

DBGET integrated database retrieval system