Gemmobacter fulvus: KM031_09960 Help Entry KM031_09960       CDS       T07830                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism gfu  Gemmobacter fulvus Brite KEGG Orthology (KO) [BR:gfu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:gfu03110]     KM031_09960 (grxC) Chaperones and folding catalysts [BR:gfu03110]  Protein folding catalysts   Protein disulfide isomerase    KM031_09960 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR Thioredoxin_3 Mpt_N Motif Other DBs NCBI-ProteinID:  QWK89200 UniProt:  A0A975P3J5 LinkDB All DBs Position 2055938..2056195 Genome browser AA seq 85 aa AA seqDB search MKPVEIYTTPTCPYCLAAKRLLTKKGAAFTEIDVSRDPALRDAMTARAGGRRSVPQIFIG GQHVGGSDDIHALDHAGKLDPLLAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaacccgtcgaaatctataccaccccgacctgcccctattgccttgccgccaaacgg ctgctgaccaagaagggcgcggccttcaccgagattgacgtgagccgcgatcccgccttg cgtgatgcgatgacagcgcgggcaggcgggcggcgatctgtgccgcagatcttcatcggt gggcagcatgtgggtggcagtgacgatattcacgcgctggatcatgccggcaagcttgac ccgcttctggcgggctga

DBGET integrated database retrieval system