Gemmobacter fulvus: KM031_10785 Help Entry KM031_10785       CDS       T07830                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism gfu  Gemmobacter fulvus Brite KEGG Orthology (KO) [BR:gfu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gfu03032]     KM031_10785    03036 Chromosome and associated proteins [BR:gfu03036]     KM031_10785    03400 DNA repair and recombination proteins [BR:gfu03400]     KM031_10785 DNA replication proteins [BR:gfu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     KM031_10785 Chromosome and associated proteins [BR:gfu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     KM031_10785 DNA repair and recombination proteins [BR:gfu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       KM031_10785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG SasG_E Motif Other DBs NCBI-ProteinID:  QWK89344 UniProt:  A0A975RZR1 LinkDB All DBs Position 2241187..2241474 Genome browser AA seq 95 aa AA seqDB search MSKPMTKTQLVAALAETMGADKKVAGSALDAIAEVVAREVAAGGAVTLPGLGKVVCRERP ERQVRNPATGETVTKAADKQVKFTIAKALKDSVNG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaaccgatgaccaagacgcagctggtggccgctctggccgaaaccatgggcgcc gacaagaaagtcgccggctctgctctggatgcgattgccgaagtcgtggcgcgcgaagtg gccgccggtggcgccgtgacgctgccgggccttggcaaggtcgtgtgccgcgagcgtccc gagcgtcaggtccgtaacccggccacgggcgaaaccgtgaccaaggcggctgacaagcag gtgaaattcaccatcgccaaagccctgaaagacagcgtgaacggctga

DBGET integrated database retrieval system