Gallus gallus (chicken): 100858359 Help Entry 100858359         CDS       T01006                                  Symbol BBIP1 Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism gga  Gallus gallus (chicken) Brite KEGG Orthology (KO) [BR:gga00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gga03037]     100858359 (BBIP1) Cilium and associated proteins [BR:gga03037]  Primary cilia and associated proteins   BBSome    100858359 (BBIP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  100858359 NCBI-ProteinID:  NP_001264440 CGNC:  64722 Ensembl:  ENSGALG00000037714 LinkDB All DBs Position 6:complement(27109662..27112575) Genome browser AA seq 68 aa AA seqDB search MPEGKGAFREVLPKQGQLSVEDTAGMVLCKPKVLPLKSVSLEKLEQLQRAAMEASRPPEG TPGPQPRP NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgccggaggggaagggcgcgttccgggaggtgctgcccaaacaagggcagctgtcggtg gaggacacggccggcatggtgctgtgcaagcccaaggtgctgcccctcaagtcggtgtcg ctggagaagctggagcagctgcagcgcgcggccatggaggcgtcgcggccgcccgagggc actccgggcccccagccgcggccctag

DBGET integrated database retrieval system