Gallus gallus (chicken): 373958 Help Entry 373958            CDS       T01006                                  Symbol IL2, IL-2, interleukin-2 Name (RefSeq) interleukin-2 precursor   KO K05429   interleukin 2 Organism gga  Gallus gallus (chicken) Pathway gga04060   Cytokine-cytokine receptor interaction gga04625   C-type lectin receptor signaling pathway gga04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:gga00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     373958 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     373958 (IL2)    04672 Intestinal immune network for IgA production     373958 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gga04052]     373958 (IL2)    00536 Glycosaminoglycan binding proteins [BR:gga00536]     373958 (IL2) Cytokines and neuropeptides [BR:gga04052]  Cytokines   Interleukins    373958 (IL2) Glycosaminoglycan binding proteins [BR:gga00536]  Heparan sulfate / Heparin   Cytokines    373958 (IL2) SSDB OrthologParalogGFIT Motif Pfam:  IL15 DUF5482 DUF4132 Motif Other DBs NCBI-GeneID:  373958 NCBI-ProteinID:  NP_989484 CGNC:  48979 Ensembl:  ENSGALG00000011849 UniProt:  O42288 A0A8V0XJ24 LinkDB All DBs Position 4:53232430..53235481 Genome browser AA seq 143 aa AA seqDB search MMCKVLIFGCISVAMLMTTAYGASLSSEKWKTLQTLIKDLEILENIKNKIHLELYTPTET QECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICE ANNKKKFPDFLHELTNFVRYLQK NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcaaagtactgatctttggctgtatttcggtagcaatgctaatgactacagct tatggagcatctctatcatcagaaaaatggaaaactcttcaaacattaataaaggattta gaaatattggaaaatatcaagaataagattcatctcgagctctacacaccaactgagacc caggagtgcacccagcaaactctgcagtgttacctgggagaagtggttactctgaagaaa gaaactgaagatgacactgaaattaaagaagaatttgtaactgctattcaaaatatcgaa aagaacctcaagagtcttacgggtctaaatcacaccggaagtgaatgcaagatctgtgaa gctaacaacaagaaaaaatttcctgattttctccatgaactgaccaactttgtgagatat ctgcaaaaataa

DBGET integrated database retrieval system