Gallus gallus (chicken): 395149 Help Entry 395149            CDS       T01006                                  Symbol MRAS Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism gga  Gallus gallus (chicken) Pathway gga04010   MAPK signaling pathway gga04137   Mitophagy - animal gga04140   Autophagy - animal gga04218   Cellular senescence gga04371   Apelin signaling pathway gga04625   C-type lectin receptor signaling pathway gga04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:gga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     395149 (MRAS)    04371 Apelin signaling pathway     395149 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     395149 (MRAS)    04137 Mitophagy - animal     395149 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     395149 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     395149 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     395149 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:gga04031]     395149 (MRAS) GTP-binding proteins [BR:gga04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     395149 (MRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  395149 NCBI-ProteinID:  NP_989820 CGNC:  8810 Ensembl:  ENSGALG00000011592 UniProt:  Q6JHX4 LinkDB All DBs Position 7:25228578..25263398 Genome browser AA seq 208 aa AA seqDB search MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGREMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGSHKLQCAIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggctaccagcgctgttcccagcgaaaacctccccacatacaagctggtggtggttgga gatggcggcgtggggaagagcgctctcaccattcagtttttccagaagatttttgtgcca gactatgacccaactattgaagactcctacctgaagcacacagaaatagacgggcagtgg gcaattcttgatgttctggacacggcaggccaggaggagttcagcgcgatgcgggagcag tacatgaggactggagatggtttccttatagtctactctgtgacagacaaggccagcttt gagcacgtggaccgtttccaccagctgatcctcagagtcaaagacagggagtcctttcca atgattctggtggcaaacaaagttgatctaatgcatttacggaaaattaccagagaacag ggaagagaaatggcaacaaaacataatattccatatatagaaactagtgccaaggaccca cctctaaatgttgacaaggccttccatgatctcgtaagggtaataaggcaacagatccca gagaaaagccagaagaagaagaaaaagaccaaatggagaggggatcgagccacaggctcc cacaaactccaatgtgcaattttgtga

DBGET integrated database retrieval system