Gallus gallus (chicken): 395197 Help Entry 395197            CDS       T01006                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism gga  Gallus gallus (chicken) Pathway gga04137   Mitophagy - animal gga04144   Endocytosis gga04145   Phagosome gga04148   Efferocytosis gga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gga00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     395197 (RAB5C)    04145 Phagosome     395197 (RAB5C)    04137 Mitophagy - animal     395197 (RAB5C)    04148 Efferocytosis     395197 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     395197 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gga04131]     395197 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gga04147]     395197 (RAB5C)    04031 GTP-binding proteins [BR:gga04031]     395197 (RAB5C) Membrane trafficking [BR:gga04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     395197 (RAB5C)  Endosome - Lysosome transport     395197 (RAB5C) Exosome [BR:gga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    395197 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    395197 (RAB5C)   Exosomal proteins of colorectal cancer cells    395197 (RAB5C)   Exosomal proteins of bladder cancer cells    395197 (RAB5C) GTP-binding proteins [BR:gga04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     395197 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  395197 NCBI-ProteinID:  NP_989856 CGNC:  2444 Ensembl:  ENSGALG00000003359 UniProt:  Q98932 LinkDB All DBs Position 27:complement(7656878..7667208) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFVRAKNWVKELQ RQASPNIVIALAGNKADLATKRAVDFQDAQTYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAPGGPGRNRVVDLQESSQPSRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcaggtcgaggtggagctgctcgaccgaacggaccagctgctggaaacaaaatctgt cagttcaaactcgtcctcttgggagagtcggcggtggggaaatccagccttgttctgcgc ttcgtgaaggggcagttccatgagtaccaggagagcacgattggagctgccttcctaacg cagacagtctgtctggatgacacaacggtgaagtttgaaatatgggatacggcaggacag gagcggtatcacagcctggcacccatgtattaccgaggtgcccaggcagccattgttgtc tacgacatcactaacacagacacatttgtacgagccaagaactgggtgaaagagttgcag aggcaggctagccccaatattgtaattgcactagcaggaaacaaggcagaccttgctacc aagagagctgtggacttccaggatgcacaaacatatgcagatgacaacagcttgctgttc atggagacatcagcaaagacagcaatgaatgtgaatgaaatcttcatggcaatagccaag aaactgccaaaaaacgaaccccagaatgctccaggcggcccgggcaggaatcgggtggtc gaccttcaggagagcagtcagcccagcaggagccagtgctgcagcaattga

DBGET integrated database retrieval system