Gallus gallus (chicken): 396229 Help Entry 396229            CDS       T01006                                  Symbol HRAS Name (RefSeq) GTPase HRas precursor   KO K02833   GTPase HRas Organism gga  Gallus gallus (chicken) Pathway gga04010   MAPK signaling pathway gga04012   ErbB signaling pathway gga04068   FoxO signaling pathway gga04137   Mitophagy - animal gga04140   Autophagy - animal gga04144   Endocytosis gga04150   mTOR signaling pathway gga04210   Apoptosis gga04218   Cellular senescence gga04370   VEGF signaling pathway gga04371   Apelin signaling pathway gga04510   Focal adhesion gga04540   Gap junction gga04625   C-type lectin receptor signaling pathway gga04810   Regulation of actin cytoskeleton gga04910   Insulin signaling pathway gga04912   GnRH signaling pathway gga04916   Melanogenesis gga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     396229 (HRAS)    04012 ErbB signaling pathway     396229 (HRAS)    04370 VEGF signaling pathway     396229 (HRAS)    04371 Apelin signaling pathway     396229 (HRAS)    04068 FoxO signaling pathway     396229 (HRAS)    04150 mTOR signaling pathway     396229 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     396229 (HRAS)    04140 Autophagy - animal     396229 (HRAS)    04137 Mitophagy - animal     396229 (HRAS)   09143 Cell growth and death    04210 Apoptosis     396229 (HRAS)    04218 Cellular senescence     396229 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     396229 (HRAS)    04540 Gap junction     396229 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     396229 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     396229 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     396229 (HRAS)    04912 GnRH signaling pathway     396229 (HRAS)    04916 Melanogenesis     396229 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     396229 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gga04131]     396229 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gga04147]     396229 (HRAS)    04031 GTP-binding proteins [BR:gga04031]     396229 (HRAS) Membrane trafficking [BR:gga04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     396229 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     396229 (HRAS) Exosome [BR:gga04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    396229 (HRAS)   Exosomal proteins of colorectal cancer cells    396229 (HRAS) GTP-binding proteins [BR:gga04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     396229 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  396229 NCBI-ProteinID:  NP_990623 CGNC:  5197 Ensembl:  ENSGALG00000034526 UniProt:  P08642 F5ANT1 LinkDB All DBs Position 5:16242807..16252401 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtagtgggagctggaggtgtcgggaagagcgctttgacg atacagctcattcagaaccattttgttgatgagtacgaccccacaatagaggattcctac agaaagcaagtcgtcatcgatggagagacctgtttgctggacatcctggatacggcgggg caggaggagtacagtgccatgcgagaccagtacatgagaacgggggaaggattcctgtgc gtctttgccattaacaacaccaagtcctttgaggacatccaccagtacagggagcagatc aagagggtgaaagactcagatgatgtccccatggtgctggtgggaaataaatgtgatctg ccagcacggacagtggagacccggcaagcgcaggacctggcccggagttacgggatcccc tacatagaaacgtcggccaaaaccagacagggcgtcgaagatgccttctataccttagtg cgggagatccgtcagcataaactgcgcaagctgaacccaccagatgagagtggccctggc tgcatgaactgtaaatgcgtgatatcgtga

DBGET integrated database retrieval system