Gallus gallus (chicken): 396506 Help Entry 396506            CDS       T01006                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism gga  Gallus gallus (chicken) Pathway gga04382   Cornified envelope formation gga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gga00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     396506 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     396506 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gga04147]     396506 (S100A10) Exosome [BR:gga04147]  Exosomal proteins   Exosomal proteins of microglial cells    396506 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  396506 NCBI-ProteinID:  NP_990837 CGNC:  49842 Ensembl:  ENSGALG00000028774 UniProt:  P27003 LinkDB All DBs Position 25:complement(464701..466723) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETLMFTFHKYAGDKNYLSKEDLRALMEKEFPGFLENQRDPMALDKIMKDLD QCRDGKVGFQSFFSLVAGLTIACNDYFVVHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtcccagatggagcacgccatggagacgctgatgttcaccttccacaaatacgcg ggtgacaagaactacctgagcaaggaggacctgcgtgcgctgatggagaaggagttcccc ggattcctggagaaccagcgcgaccctatggcgctggataagatcatgaaggacctggac cagtgccgggatggcaaagtgggcttccagagcttcttctcactggtggctggactgacc atcgcctgcaatgactacttcgtggtgcacatgaagcagaaggggcggaagtga

DBGET integrated database retrieval system