Gallus gallus (chicken): 416016 Help Entry 416016            CDS       T01006                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism gga  Gallus gallus (chicken) Pathway gga04137   Mitophagy - animal gga04140   Autophagy - animal gga04144   Endocytosis gga04145   Phagosome gga04148   Efferocytosis gga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gga00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     416016 (RAB7A)    04145 Phagosome     416016 (RAB7A)    04140 Autophagy - animal     416016 (RAB7A)    04137 Mitophagy - animal     416016 (RAB7A)    04148 Efferocytosis     416016 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     416016 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gga04131]     416016 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gga04147]     416016 (RAB7A)    04031 GTP-binding proteins [BR:gga04031]     416016 (RAB7A) Membrane trafficking [BR:gga04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     416016 (RAB7A) Exosome [BR:gga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    416016 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    416016 (RAB7A)   Exosomal proteins of colorectal cancer cells    416016 (RAB7A)   Exosomal proteins of bladder cancer cells    416016 (RAB7A) GTP-binding proteins [BR:gga04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     416016 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_24 AAA_16 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  416016 NCBI-ProteinID:  XP_003642026 CGNC:  4408 Ensembl:  ENSGALG00000005902 UniProt:  E1C0F3 LinkDB All DBs Position 12:complement(9533938..9560436) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatcctcggagactctggggtgggg aagacatcactcatgaaccagtatgtgaacaagaaatttagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaggtcatggtggatgacaggctagtgacaatgcag atatgggatacagcaggccaagaacgattccagtctctgggagttgccttctacagggga gcagactgctgtgtgctggtgtttgatgtcacggcccctaacacattcaaaacccttgac agctggagggacgagtttctcattcaggccagtccaagggatcctgagaactttcccttt gttgtcctgggaaacaagatcgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aacgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaacgaattccccgaacccatcaaactagacaagaacgaccgagtgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system