Gallus gallus (chicken): 422303 Help Entry 422303            CDS       T01006                                  Symbol CETN2 Name (RefSeq) centrin-2   KO K10840   centrin-2 Organism gga  Gallus gallus (chicken) Pathway gga03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gga00001]  09120 Genetic Information Processing   09124 Replication and repair    03420 Nucleotide excision repair     422303 (CETN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gga03019]     422303 (CETN2)    03036 Chromosome and associated proteins [BR:gga03036]     422303 (CETN2)    03400 DNA repair and recombination proteins [BR:gga03400]     422303 (CETN2) Messenger RNA biogenesis [BR:gga03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      422303 (CETN2) Chromosome and associated proteins [BR:gga03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     422303 (CETN2)    Centrosome duplication proteins     Centriole replication proteins      422303 (CETN2) DNA repair and recombination proteins [BR:gga03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      XPC-HR23B-CETN2 complex       422303 (CETN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_9 AIF-1 EF-hand_5 EH EF_EFCAB10_C EF-hand_14 Dockerin_1 SRI DUF7645 SurA_N_3 SUB1_ProdP9 HerA_C RTP LETM1_RBD DUF7390 DUF5580_M SAXO5-like CARF_Card1 Motif Other DBs NCBI-GeneID:  422303 NCBI-ProteinID:  NP_001264569 CGNC:  51692 Ensembl:  ENSGALG00000007510 UniProt:  F1NM71 LinkDB All DBs Position 4:11283946..11288350 Genome browser AA seq 172 aa AA seqDB search MASSFKKPSLGAASQRKKSSPKPELTEEQKQEIREAFDLFDTDGTGNIDVKELKVAMRAL GFEPKKEEIKKMISDIDKEGTGKISFNDFLVVMTQKMAEKDSKEEILKAFKLFDDDETGK ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atggcctccagcttcaagaagccctcgctgggagcagcgtcccagaggaagaaatcgagt cccaagccagagttgactgaagagcagaagcaggaaatccgggaggccttcgacctgttt gacacagatggcactgggaatatagatgttaaggagctaaaggtggccatgagagcctta gggtttgaacctaagaaagaagaaatcaagaaaatgatatcagatattgataaggaagga acaggaaaaatcagcttcaatgacttcttggtggtgatgacccagaaaatggctgaaaaa gattccaaagaggagattctcaaagcatttaagctctttgatgatgatgaaactggcaaa atctctttcaaaaacctcaaacgtgtagccaaagaactgggtgaaaaccttacagatgaa gagctgcaggaaatgattgatgaagcagatagagatggggatggggaagtgaacgagcag gaattcttgaggatcatgaagaagaccagcctttactga

DBGET integrated database retrieval system