Gallus gallus (chicken): 423062 Help Entry 423062            CDS       T01006                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism gga  Gallus gallus (chicken) Pathway gga04010   MAPK signaling pathway gga04137   Mitophagy - animal gga04140   Autophagy - animal gga04218   Cellular senescence gga04371   Apelin signaling pathway gga04625   C-type lectin receptor signaling pathway gga04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:gga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     423062 (RRAS2)    04371 Apelin signaling pathway     423062 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     423062 (RRAS2)    04137 Mitophagy - animal     423062 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     423062 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     423062 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     423062 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gga04147]     423062 (RRAS2)    04031 GTP-binding proteins [BR:gga04031]     423062 (RRAS2) Exosome [BR:gga04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    423062 (RRAS2)   Exosomal proteins of bladder cancer cells    423062 (RRAS2) GTP-binding proteins [BR:gga04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     423062 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 RsgA_GTPase Motif Other DBs NCBI-GeneID:  423062 NCBI-ProteinID:  NP_001006466 CGNC:  4490 Ensembl:  ENSGALG00000005998 UniProt:  Q5ZIW8 LinkDB All DBs Position 5:complement(10585170..10619898) Genome browser AA seq 203 aa AA seqDB search MAAGCRDGPGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERA ARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFP MILVGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRLNVDQAFHELVRVIRKFQEQ ECPPSPEPTRKEKDKKGCHCVIF NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggccgcgggctgcagggacggcccggggcaggagaagtaccggctggtggtggtgggc ggcggcggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgttacg gattatgaccctacaatcgaagactcctacaccaaacagtgtgtgatagatgaaagggct gcgcgcttggacattctggatacagcgggacaagaagaatttggagccatgcgtgaacag tacatgaggacaggggagggttttctgctcgttttctcagtcactgacagaggaagtttt gaagaaatctataagtttcaacgacagattcttagagtgaaagatcgtgatgagtttcct atgattctagttggtaataaagcagatctggaccaccaaagacaggtgacacaagaggaa ggtcagcagctagcacgacaacttaaagtaacttacatggaagcctcagcaaagatcaga ttgaatgtagaccaagcttttcatgaacttgtcagagttataaggaaatttcaagaacaa gagtgccctccttcaccagagccgacacggaaagagaaagacaaaaaaggctgccattgt gtaattttctga

DBGET integrated database retrieval system