Gallus gallus (chicken): 427708 Help Entry 427708            CDS       T01006                                  Symbol DYL1 Name (RefSeq) dynein light chain 1 cytoplasmic   KO K10418   dynein light chain LC8-type Organism gga  Gallus gallus (chicken) Pathway gga04814   Motor proteins gga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gga00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     427708 (DYL1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     427708 (DYL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gga03037]     427708 (DYL1)    04812 Cytoskeleton proteins [BR:gga04812]     427708 (DYL1) Cilium and associated proteins [BR:gga03037]  Motile cilia and associated proteins   Dynein arm    427708 (DYL1) Cytoskeleton proteins [BR:gga04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      427708 (DYL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  427708 NCBI-ProteinID:  NP_001264808 CGNC:  53172 Ensembl:  ENSGALG00000007153 UniProt:  Q5F412 LinkDB All DBs Position 15:complement(9563292..9565826) Genome browser AA seq 89 aa AA seqDB search MSDRKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagtgaccgaaaggcagtgatcaaaaacgcggacatgtcggaggagatgcagcaggac gctgtggagtgcgctacgcaggcactggagaagtacaacatcgagaaggacatcgcagcg cacatcaagaaggaatttgacaagaaatacaatcctacttggcactgcatcgtgggaagg aactttggcagctacgtgactcatgagaccaaacacttcatctacttctacctcggccaa gtcgctattcttctcttcaagtctggttag

DBGET integrated database retrieval system