Gallus gallus (chicken): 428352 Help Entry 428352            CDS       T01006                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism gga  Gallus gallus (chicken) Pathway gga04140   Autophagy - animal gga04144   Endocytosis gga04530   Tight junction Brite KEGG Orthology (KO) [BR:gga00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     428352 (RAB8A)    04140 Autophagy - animal     428352 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     428352 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gga04131]     428352 (RAB8A)    03036 Chromosome and associated proteins [BR:gga03036]     428352 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gga04147]     428352 (RAB8A)    04031 GTP-binding proteins [BR:gga04031]     428352 (RAB8A) Membrane trafficking [BR:gga04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     428352 (RAB8A)  Autophagy   Other autophagy associated proteins     428352 (RAB8A) Chromosome and associated proteins [BR:gga03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     428352 (RAB8A) Exosome [BR:gga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    428352 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    428352 (RAB8A)   Exosomal proteins of colorectal cancer cells    428352 (RAB8A) GTP-binding proteins [BR:gga04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     428352 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU MMR_HSR1 SRPRB DUF3963 Motif Other DBs NCBI-GeneID:  428352 NCBI-ProteinID:  NP_001026675 CGNC:  66558 Ensembl:  ENSGALG00000028851 UniProt:  Q5F470 LinkDB All DBs Position 28:complement(4524689..4537499) Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCALFRFSEDAFNATFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIRNWVRNIEEHASPDVEKMILG NKCDANDKRQVSREQGEKLAASFGIKFMETSAKANINIENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKKSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacgtacgactatctgttcaagctgctgctcatcggcgactcgggcgtgggg aagacgtgcgcgctcttccgcttctccgaggatgccttcaacgccaccttcatctccact atcggcattgattttaagattagaactatcgagctagatggcaagagaatcaagctgcag atatgggataccgccgggcaggagcgattccgcaccatcacaaccgcgtactacagggga gccatgggcattatgttggtctatgacatcaccaatgaaaagtcttttgaaaatattcgg aactgggtcaggaacattgaagagcatgcctctccagacgtcgaaaaaatgatccttggg aacaaatgtgacgcaaatgacaaaagacaagtttctagagagcaaggggagaagcttgca gcgagttttggaattaaattcatggagaccagcgcaaaagcaaatataaacatagagaat gcatttttcactcttgccagagatatcaaagcaaaaatggacaagaagttggaaggcaat agcccacagggcagcaaccagggagtcaaaatcacaccagaccagcaaaagaaaagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system