Gallus gallus (chicken): 769725 Help Entry 769725            CDS       T01006                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism gga  Gallus gallus (chicken) Pathway gga04144   Endocytosis Brite KEGG Orthology (KO) [BR:gga00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     769725 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gga04131]     769725 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gga04147]     769725 (ARF4)    04031 GTP-binding proteins [BR:gga04031]     769725 (ARF4) Membrane trafficking [BR:gga04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     769725 (ARF4) Exosome [BR:gga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    769725 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    769725 (ARF4)   Exosomal proteins of colorectal cancer cells    769725 (ARF4) GTP-binding proteins [BR:gga04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     769725 (ARF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K FLAD1_M Csa3_N GTP_EFTU RXYLT1_N CRISPR_Cas2 TPM_phosphatase AAA_18 Motif Other DBs NCBI-GeneID:  769725 NCBI-ProteinID:  XP_015148874 CGNC:  55483 Ensembl:  ENSGALG00000005622 UniProt:  Q5ZKR9 LinkDB All DBs Position 12:complement(9119457..9129861) Genome browser AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIEEAADELQKMLQEDELRDAV LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatctcctcgctcttctcgcgcctcttcggcaagaagcagatgcgcatc ctcatggttggtttggatgctgctggtaagacgactatcctttataagctgaaactagga gaaattgtcaccacaattcccactattggttttaatgtggaaacggtagaatacaagaac atttgtttcacagtttgggatgttggtggtcaagataaaatcagacctctttggaggcac tacttccaaaatacacagggcctcatctttgtggtggatagcaacgacagagagagaatc gaggaagcagcagatgagctgcagaaaatgcttcaggaggatgagctgcgagatgcagtg ctgctgctgtttgcaaacaagcaagatctgccaaatgccatggcaatcagcgaaatgacg gataaactaggtcttcagtccctgcgtaacagaacttggtatgtccaagctacctgtgct acgcaaggaactggtctgtatgagggacttgactggctctcaaacgaactctcaaaacgc taa

DBGET integrated database retrieval system