KEGG   Geobacillus sp. GHH01: GHH_c12630
Entry
GHH_c12630        CDS       T02455                                 
Symbol
yneI
Name
(GenBank) two-component response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh02020  Two-component system
ggh02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GHH_c12630 (yneI)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    GHH_c12630 (yneI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ggh02022]
    GHH_c12630 (yneI)
   02035 Bacterial motility proteins [BR:ggh02035]
    GHH_c12630 (yneI)
Two-component system [BR:ggh02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   GHH_c12630 (yneI)
Bacterial motility proteins [BR:ggh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GHH_c12630 (yneI)
SSDB
Motif
Pfam: Response_reg Aldolase
Other DBs
NCBI-ProteinID: AGE21801
LinkDB
Position
1241431..1241787
AA seq 118 aa
MAAILIADDAKFMRVTLARILEKTDHTVAGEAENGKEAVELYRRLRPDLVIMDITMPVMN
GIEAVRAIREIDPGAKIIICSALGQQRMVVEAIEAGAADFIVKPFEETRVLEAIARLL
NT seq 357 nt   +upstreamnt  +downstreamnt
atggctgccattttaattgctgacgatgcgaagtttatgcgggtaacgctggcgcgcata
ttggaaaaaacggatcacaccgtagccggtgaggcggaaaacggcaaagaggcggtcgag
ctgtatcgccggctgcgccccgatcttgtcatcatggacattacgatgccggtcatgaat
gggattgaagcggtgcgggcgattagggagatcgatcccggggcgaaaatcatcatctgc
tcggcgctcgggcagcagcgtatggtcgttgaggccattgaagccggagcggccgacttc
atcgtcaagccgtttgaagaaacccgcgtgctcgaggcgattgcccgtcttttgtaa

DBGET integrated database retrieval system