Geobacillus sp. GHH01: GHH_c26020 Help Entry GHH_c26020        CDS       T02455                                  Symbol sda Name (GenBank) sporulation inhibitor   KO K06371   developmental checkpoint coupling sporulation initiation to replication initiation Organism ggh  Geobacillus sp. GHH01 Brite KEGG Orthology (KO) [BR:ggh00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     GHH_c26020 (sda) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sda Motif Other DBs NCBI-ProteinID:  AGE23113 UniProt:  L7ZUE2 LinkDB All DBs Position 2592154..2592294 Genome browser AA seq 46 aa AA seqDB search MKHLSDELLIESYFKAKELNLSPEFIELIEKEIQRRSLTHKIKLSS NT seq 141 nt NT seq  +upstreamnt  +downstreamnt atgaaacatttgtccgacgagctgttgatcgagtcgtacttcaaggcgaaagagctcaac ctcagcccggaattcatcgagttgattgaaaaagaaatccagcgccgttcattgacccac aaaattaagctgtcctcataa

DBGET integrated database retrieval system