Gavialis gangeticus (Gharial): 109296923 Help Entry 109296923         CDS       T07453                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ggn  Gavialis gangeticus (Gharial) Pathway ggn04010   MAPK signaling pathway ggn04020   Calcium signaling pathway ggn04114   Oocyte meiosis ggn04218   Cellular senescence ggn04310   Wnt signaling pathway ggn04370   VEGF signaling pathway ggn04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:ggn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109296923 (PPP3R1)    04310 Wnt signaling pathway     109296923 (PPP3R1)    04370 VEGF signaling pathway     109296923 (PPP3R1)    04020 Calcium signaling pathway     109296923 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109296923 (PPP3R1)    04218 Cellular senescence     109296923 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109296923 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ggn01009]     109296923 (PPP3R1) Protein phosphatases and associated proteins [BR:ggn01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109296923 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  109296923 NCBI-ProteinID:  XP_019372111 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcgcactttgatgcggatgagattaaacgtctaggaaagagatttaagaagctt gatttggacaattctggctccctgagtgtagaagagttcatgtctttgcctgagttgcaa cagaatccattagtacaaagagtaatagacatatttgacacagatgggaatggagaagtg gacttcaaagaatttatagaaggagtctcccagttcagtgtcaaaggggataaggagcag aagttgaggtttgctttccgcatttatgatatggacaaagatggctatatctccaatggg gaactcttccaggtgctgaagatgatggtggggaacaatctcaaagacactcagttacag caaattgtagacaaaaccataattaatgcagataaggatggtgatggaagaatatccttt gaagagttctgtgctgttgtaggaggcctagatatccacaaaaaaatggtggtagatgtg tga

DBGET integrated database retrieval system