Gavialis gangeticus (Gharial): 109299505 Help Entry 109299505         CDS       T07453                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism ggn  Gavialis gangeticus (Gharial) Pathway ggn04010   MAPK signaling pathway ggn04068   FoxO signaling pathway ggn04081   Hormone signaling ggn04114   Oocyte meiosis ggn04140   Autophagy - animal ggn04150   mTOR signaling pathway ggn04810   Regulation of actin cytoskeleton ggn04910   Insulin signaling pathway ggn04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:ggn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109299505 (INS)    04068 FoxO signaling pathway     109299505 (INS)    04150 mTOR signaling pathway     109299505 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     109299505 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109299505 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     109299505 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109299505 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     109299505 (INS)    04914 Progesterone-mediated oocyte maturation     109299505 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ggn04052]     109299505 (INS) Cytokines and neuropeptides [BR:ggn04052]  Neuropeptides   Unclassified    109299505 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  109299505 NCBI-ProteinID:  XP_019375557 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIHSLPLLALLALSSPSVSYAAANQRLCGSHLVDALYLVCGERGFFYSPKGRRDLEQ PLVNGPLRNEVEELAFQQQEYEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccactcactacctctcctggccctccttgctctctccagccccagc gtcagctatgctgccgctaaccagcgcctctgtggctctcacttggtggatgctctctat ctggtgtgtggtgaaaggggtttcttctactctcctaaaggtcgacgggaccttgaacag cctctagtgaatgggcctctgcggaatgaagtggaagagctagcattccaacagcaggaa tatgagaaagtgaagaggggaattgttgagcaatgttgccataacacctgctccctttac cagctggaaaactattgcaactag

DBGET integrated database retrieval system