Gavialis gangeticus (Gharial): 109300222 Help Entry 109300222         CDS       T07453                                  Symbol RAB10 Name (RefSeq) ras-related protein Rab-10   KO K07903   Ras-related protein Rab-10 Organism ggn  Gavialis gangeticus (Gharial) Pathway ggn04144   Endocytosis Brite KEGG Orthology (KO) [BR:ggn00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109300222 (RAB10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ggn04131]     109300222 (RAB10)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ggn04147]     109300222 (RAB10)    04031 GTP-binding proteins [BR:ggn04031]     109300222 (RAB10) Membrane trafficking [BR:ggn04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     109300222 (RAB10)  Protein recycling   Rab GTPases and associated proteins     109300222 (RAB10) Exosome [BR:ggn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109300222 (RAB10)   Exosomal proteins of other body fluids (saliva and urine)    109300222 (RAB10)   Exosomal proteins of colorectal cancer cells    109300222 (RAB10)   Exosomal proteins of bladder cancer cells    109300222 (RAB10) GTP-binding proteins [BR:ggn04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     109300222 (RAB10) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Efg1 DUF3963 Motif Other DBs NCBI-GeneID:  109300222 NCBI-ProteinID:  XP_019376409 LinkDB All DBs Position Unknown AA seq 168 aa AA seqDB search MADISFFLPLGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDIT NAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRVVLKAKGEQIAREHGIRFFETS AKANINIEKAFLTLAEDILRKTPVKEPNSENVDITSGSGVTGWKSKCC NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atggctgacatttctttctttcttcccctaggaatagacttcaagatcaaaacagttgaa ttacaaggaaagaagatcaagctacaaatatgggacacagcaggacaggagcgatttcac accatcaccacctcctactacagaggcgccatgggaattatgctagtgtatgacatcact aatgccaaaagttttgaaaacatcagcaaatggctcagaaacatagatgagcatgccaat gaagatgttgagaggatgctgttaggaaacaagtgtgacatggaagataaaagagttgtc ctcaaagcaaaaggagaacagattgcaagggagcatggtattaggtttttcgaaactagt gcaaaagcaaatataaacattgagaaggcattcctcacattagcagaagacattcttcga aagacccctgtaaaagagcccaacagtgaaaatgtagatatcaccagtggaagtggagtg acaggctggaagagcaagtgttgctga

DBGET integrated database retrieval system