Gavialis gangeticus (Gharial): 109303662 Help Entry 109303662         CDS       T07453                                  Symbol FGF20 Name (RefSeq) fibroblast growth factor 20   KO K04358   fibroblast growth factor Organism ggn  Gavialis gangeticus (Gharial) Pathway ggn04010   MAPK signaling pathway ggn04020   Calcium signaling pathway ggn04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ggn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109303662 (FGF20)    04020 Calcium signaling pathway     109303662 (FGF20)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109303662 (FGF20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ggn04052]     109303662 (FGF20)    00536 Glycosaminoglycan binding proteins [BR:ggn00536]     109303662 (FGF20) Cytokines and neuropeptides [BR:ggn04052]  Cytokines   Growth factors (RTK binding)    109303662 (FGF20) Glycosaminoglycan binding proteins [BR:ggn00536]  Heparan sulfate / Heparin   Growth factors/receptors    109303662 (FGF20) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  109303662 NCBI-ProteinID:  XP_019381414 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MSGILEFMSVAVGLVSIRGVDSGLYLGMNEKGELYGSEKLSPECIFREQFEENWYNTYSS NVYKHGDSGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDVLGYS NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtatccttgaattcatgagtgtggcagtgggactggtcagtattagaggtgtg gacagtggcctttacctcggaatgaatgaaaagggagaactctatggatctgagaaacta agtcctgaatgcatcttcagggaacagtttgaagaaaattggtataatacttactcctcc aatgtgtacaagcatggagactcgggtcggcgatactttgtagcacttaacaaagatggt actcccagagatggggcacgatccaaaagacaccagaaattcacacactttctaccgagg ccagtggatccagagagagttccagagctctataaagatgtattaggatacagttaa

DBGET integrated database retrieval system