Gorilla gorilla gorilla (western lowland gorilla): 101133932
Help
Entry
101133932 CDS
T02442
Symbol
NDUFS3, CI-30kD
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
KO
K03936
NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:
7.1.1.2
]
Organism
ggo
Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00190
Oxidative phosphorylation
ggo01100
Metabolic pathways
ggo04714
Thermogenesis
ggo04723
Retrograde endocannabinoid signaling
ggo04932
Non-alcoholic fatty liver disease
ggo05010
Alzheimer disease
ggo05012
Parkinson disease
ggo05014
Amyotrophic lateral sclerosis
ggo05016
Huntington disease
ggo05020
Prion disease
ggo05022
Pathways of neurodegeneration - multiple diseases
ggo05208
Chemical carcinogenesis - reactive oxygen species
ggo05415
Diabetic cardiomyopathy
Module
ggo_M00143
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:
ggo00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
101133932 (NDUFS3)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
101133932 (NDUFS3)
09159 Environmental adaptation
04714 Thermogenesis
101133932 (NDUFS3)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
101133932 (NDUFS3)
09164 Neurodegenerative disease
05010 Alzheimer disease
101133932 (NDUFS3)
05012 Parkinson disease
101133932 (NDUFS3)
05014 Amyotrophic lateral sclerosis
101133932 (NDUFS3)
05016 Huntington disease
101133932 (NDUFS3)
05020 Prion disease
101133932 (NDUFS3)
05022 Pathways of neurodegeneration - multiple diseases
101133932 (NDUFS3)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
101133932 (NDUFS3)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
101133932 (NDUFS3)
Enzymes [BR:
ggo01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
101133932 (NDUFS3)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Complex1_30kDa
Motif
Other DBs
NCBI-GeneID:
101133932
NCBI-ProteinID:
NP_001266569
Ensembl:
ENSGGOG00000014393
UniProt:
Q0MQG7
LinkDB
All DBs
Position
9:join(53976304..53976367,53976478..53976543,53977827..53977924,53978137..53978286,53979392..53979517,53979653..53979772,53981601..53981768)
Genome browser
AA seq
263 aa
AA seq
DB search
MVAAVARLWWRGLLGASALTRGAGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAF
GEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPT
RQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANH
PDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEA
FPVYRQPPESLKLEAGDKKPDAK
NT seq
792 nt
NT seq
+upstream
nt +downstream
nt
atggtggcggcggtggccaggctgtggtggcgcgggctcttgggggcctcggcgctgacc
aggggggctgggcgaccctccgttctgttgctgccggtgaggcgggagagcgccggggcc
gacacgcgccccactgtcagaccacggaatgatgtggcccacaagcagctctcagctttt
ggagagtatgtggctgaaatcttgcccaagtatgtccaacaagttcaggtgtcctgcttc
aatgagttagaggtctgtatccatcctgatggcgtcatcccagtgctgactttcctcagg
gatcacaccaatgcacagttcaaatccctggttgacttgacagcagtggacgtcccaact
cggcagaaccgttttgagattgtctacaacctgttgtctctgcgcttcaactcacggatc
cgtgtgaagacctacacagatgagctgacgcccattgagtctgctgtctctgtgttcaag
gcagccaactggtatgaaagggagatctgggacatgtttggagtcttctttgctaaccac
cctgatctaagaaggatcctgacagattatggcttcgagggacatcctttccggaaagac
tttcctctatctggctatgttgagttacgttatgacgatgaagtgaagcgggtggtggca
gagccggtggagttggcccaagagttccgcaaatttgacctgaacagcccctgggaggct
ttcccagtctatcgccaacccccggagagtctcaagcttgaagccggagacaagaagcct
gaagccaagtag
DBGET
integrated database retrieval system