KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101133932
Entry
101133932         CDS       T02442                                 
Symbol
NDUFS3, CI-30kD
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00190  Oxidative phosphorylation
ggo01100  Metabolic pathways
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04932  Non-alcoholic fatty liver disease
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05014  Amyotrophic lateral sclerosis
ggo05016  Huntington disease
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05208  Chemical carcinogenesis - reactive oxygen species
ggo05415  Diabetic cardiomyopathy
Module
ggo_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101133932 (NDUFS3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101133932 (NDUFS3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101133932 (NDUFS3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101133932 (NDUFS3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101133932 (NDUFS3)
   05012 Parkinson disease
    101133932 (NDUFS3)
   05014 Amyotrophic lateral sclerosis
    101133932 (NDUFS3)
   05016 Huntington disease
    101133932 (NDUFS3)
   05020 Prion disease
    101133932 (NDUFS3)
   05022 Pathways of neurodegeneration - multiple diseases
    101133932 (NDUFS3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101133932 (NDUFS3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101133932 (NDUFS3)
Enzymes [BR:ggo01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101133932 (NDUFS3)
SSDB
Motif
Pfam: Complex1_30kDa
Other DBs
NCBI-GeneID: 101133932
NCBI-ProteinID: NP_001266569
Ensembl: ENSGGOG00000014393
UniProt: Q0MQG7
LinkDB
Position
9:join(53976304..53976367,53976478..53976543,53977827..53977924,53978137..53978286,53979392..53979517,53979653..53979772,53981601..53981768)
AA seq 263 aa
MVAAVARLWWRGLLGASALTRGAGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAF
GEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPT
RQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANH
PDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEA
FPVYRQPPESLKLEAGDKKPDAK
NT seq 792 nt   +upstreamnt  +downstreamnt
atggtggcggcggtggccaggctgtggtggcgcgggctcttgggggcctcggcgctgacc
aggggggctgggcgaccctccgttctgttgctgccggtgaggcgggagagcgccggggcc
gacacgcgccccactgtcagaccacggaatgatgtggcccacaagcagctctcagctttt
ggagagtatgtggctgaaatcttgcccaagtatgtccaacaagttcaggtgtcctgcttc
aatgagttagaggtctgtatccatcctgatggcgtcatcccagtgctgactttcctcagg
gatcacaccaatgcacagttcaaatccctggttgacttgacagcagtggacgtcccaact
cggcagaaccgttttgagattgtctacaacctgttgtctctgcgcttcaactcacggatc
cgtgtgaagacctacacagatgagctgacgcccattgagtctgctgtctctgtgttcaag
gcagccaactggtatgaaagggagatctgggacatgtttggagtcttctttgctaaccac
cctgatctaagaaggatcctgacagattatggcttcgagggacatcctttccggaaagac
tttcctctatctggctatgttgagttacgttatgacgatgaagtgaagcgggtggtggca
gagccggtggagttggcccaagagttccgcaaatttgacctgaacagcccctgggaggct
ttcccagtctatcgccaacccccggagagtctcaagcttgaagccggagacaagaagcct
gaagccaagtag

DBGET integrated database retrieval system